PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D13G0874
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 399aa    MW: 43752.3 Da    PI: 8.9925
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D13G0874genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.65.5e-41101176176
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                  +Cqv gC++dls+ k+yh+rhkvCe+hsk+++v+v+g+eqrfCqqCsrfh l efDe+krsCr+rLa+hnerrrk 
  Gh_D13G0874 101 CCQVYGCNKDLSSSKDYHKRHKVCEAHSKTAKVIVNGIEQRFCQQCSRFHLLAEFDEGKRSCRKRLAGHNERRRKL 176
                  6*************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.4E-3496163IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.43699176IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.47E-38100180IPR004333Transcription factor, SBP-box
PfamPF031104.6E-32102175IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MGIFGAEFGN DSTKSLVSPT CMISSTSDFG EEESGSKHCS SLMDSNSQES SLIDLKLGRL  60
TDYKDAHHGK FLKETSVVSP VRPAIVPKKA RTTSLHSQIP CCQVYGCNKD LSSSKDYHKR  120
HKVCEAHSKT AKVIVNGIEQ RFCQQCSRFH LLAEFDEGKR SCRKRLAGHN ERRRKLHFNT  180
FSGKSHKLPH SFQGTKFLGT SIPKQMPFVI PNIFQVDFLH PERQAYSNQY QQVKSEEKPM  240
YSSQSAMPIT NGQSSFFHMH DSGKQHLSGT LSSATEAFDA PSAAPTVKEL SGVSRSDCAL  300
SLLSAQSLDL SSHVTGIQMT RPLINQAGLA HRSTEKSAVM SYSEKGSSFY SCGMNPTGVS  360
QEGSVVVPDA GHTANFEGKV QDLDLLSARL SGRVAKVLH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-301021751184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.136080.0ovule
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO738612510.0
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6223300.0KJ622330.1 Gossypium hirsutum SQUAMOSA promoter binding-like transcription factor (SPL22) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012464920.10.0PREDICTED: squamosa promoter-binding-like protein 6
RefseqXP_012464919.10.0PREDICTED: squamosa promoter-binding-like protein 6
TrEMBLA0A0D2TYG20.0A0A0D2TYG2_G
STRINGVIT_01s0011g00130.t011e-124(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14770918
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.17e-54SBP family protein